Skip to main content

Advertisement

Table 2 Unique peptides used in the identification of proteins from the EhV-86 virion.

From: Proteomic analysis of the EhV-86 virion

Gene Peptides used for identification of protein product
ehv015 RDIILDPNASPSDKR
ehv034 KCIAPDYNKN, KVLNETVSGYFRR
ehv035 KDRPLISENGRY, KDSEIEDLEEQNNSLDRD, KEGYDQNFIGVPSYAVRD, KGIIGVALLEGKG, KIPYVYLNPYLKR, KITAPTAALAAEAAKL, KLAGVYGCGSKT, KLATTVASDIETRK, KNILSGDLEKE, KNYDDSVFFKD, KQIETITAELEPLAEKD, KQMEQLQFEKD, KTSTDLANCTTKV, KVGGPYTVISRN, RATAQSEHVAQLLSIETNKN, RLSNLGVLSTNNQILNKN,
ehv036 KESEADLAEAKR, RELGEATDDLGDAKK
ehv038 KTTLSDITAEIADKR
ehv055 KDDVDAWKE, KDDVDAWKEESFVMRA, KTDFNSAVVKS
ehv060 KIDSWEPGELAELYVDSTRV
ehv067 KELNLVLPPGTKG, KLAVIEEIDNKL, KLIIPAETARH, RYMTPLDVARE
ehv085 KANKDAGDHFNFSGIGGRD, KDAGDHFNFSGIGGRD KDAGDHFNFSGIGGRDPVVSAELLFNNTARV, KEQLIAEAKN, KFTNGLAGLLYSN-, KIVLPGLKV, KVGGATIDTIWSELLFAMEELMGRA, KYNAAPLPVAAQMQSTEMPDFDYAYWTEAIGFHLIKR, RASLECTYVHLEAAERD, RDALTANAGTQLIVQHQAHLQQVSSNNVTARL, RDPVVSAELLFNNTARV, RLDSVELALTLQDDFGAAHDANSELFVFARS, RLTETIGRT, RNVPISDDHLRA, RQEQILYVPLPWYFTKH, RQGDLLSWMYLKI, RQGDLLSWMYLKI, RRLTETIGRT, RRPTELMKA, RRPTELMKA, RSNLVVLHAERN, RVTQKPAVWWRA
ehv100 KTTPAIGLGPPDKY, KGTCIGNLTQCTTEKG
ehv149 KCIPDLATICTGKL, KKYDCAPGTKV, KLEPGADNNCVIKA, KLNNVSTGAKK, KVGPLGEKC, KYDCAPGTKV, RAAAAWAATRG, RGMAGSAAGATSSAAKS
ehv168 KNSALMEMVKS, KSTMGAGELEVARQ, KWTGAAAAGAAAPSAADVIYKR, RGVYGPQPAGSDSSTGKT
ehv175 RRPPNILVKM, RYFEDIFNNPRN
ehv182 KEISDPEIVDLKY, KSTCMFEADRS, KYDEESSSPARK, RFVVGDFIINNQGKL
ehv189 KVVDSLYDFRI, RYNAQQSIRD
ehv191 KQNLGQSDGNLLRA
ehv195 RSNNQYNVQRR
ehv200 KSNGYDDNFVGVNKS, KVMAVSATGTTARV, RVNVSPYWPRN
ehv250 KSFEDAANTPGYLSARS
ehv301 RSMNPNDIRT, RSNEVNDTMIARS
ehv325 KEQPNTVSGERV
ehv333 KGYDVAAVQRI
ehv340 KAIGEGMEPGMIRA
ehv356 RGQTDPSQNPVVDTRF, KNPSIIGAAEKY
ehv358 KSADELNTLVKE
ehv442 KYANGSNVTLYYDPKN
ehv454 KIPTATVTTRQ, RWSGDYLEIKK, KSAVTSITLLTDLEQVRV
ehv461 KTNAIELRR, KVDVYSLSPKN, RLTEELRF, RVGAHGPVEIRV