Skip to main content

Table 1 Identification of proteins expressed at equivalent levels in developing yeast and mould phases of P. marneffei.a

From: Protein profiling of the dimorphic, pathogenic fungus, Penicillium marneffei

Spot (Fig.) Protein Name NCBI Accession (Version) Theo. pI/M r (kDa) Expt. pI/M r (kDa) Species Mascot Score NP/PD MS/MS Peptide Sequence SC (%)
B27 (2, 3) hypothetical protein (malate dehydrogenase) XP_001817504 (gi|169766066) 8.79/35.7 5.8/52.6 Aspergillus oryzae 2597 9/122 R.VSELALYDIR.G
K.RLFGVTTLDVVR.A
R.LFGVTTLDVVR.A
R.MAESLLK.A + OM
R.IQFGGDEVVK.A
R.DDLFNTNASIVR.D
K.DGAGSATLSMAMAGAR.M + 2 OM
K.AKDGAGSATLSMAMAGAR.F + 2 OM
K.VELGPNGVEKILPVGQVNAYEEK.L
27
B29 (2, 3) Cu,Zn-superoxide dismutase ABD67502 (gi|89329757) 5.74/16.1 5.9/35.0 Penicillium marneffei 5183 9/139 M.VKAVAVLR.G
K.GTVTFEQADENSPTTISWNITGHDANAER.G
K.THGAPTDDER.H
K.THGAPTDDERHVGDLGNFK.T
R.HVGDLGNFK.T
K.TDAQGNAVGFVEDK.L
K.LIGAESVLGR.T
R.TIVVHAGTDDLGR.G
K.TGNAGPRPACGVIGISA.-
71
B30 (2, 3) hypothetical protein (peroxiredoxin) XP_001226164 (gi|116200704) 5.57/25.1 6.1/45.9 Chaetomium globosum 202 2/25 R.VVKPYLR.F
R.TILSYPASTGR.N
K.IAYLYDMIDYQDTTNVDEK.G + OM
R.KIAYLYDMIDYQDTTNVDEK.G + OM
16
B31 (2, 3) hypothetical protein (nucleotide diphosphate kinase) XP_001393898 (gi|145242650) 8.45/17.2 6.5/33.9 Aspergillus niger 413 5/127 R.GLVGPIISR.F
R.TILGATNPLASAPGTIR.G
R.GDYAIDVGR.N
R.NVCHGSDSVENAQK.E
K.HSQFDWIYEK.A
38
B33 (2, 3) hypothetical protein (malate dehydrogenase) XP_001246025 (gi|119190837) 9.19/36.0 6.1/45.9 Coccidioides immitis 328 5/9 R.FAESLLK.A
R.IQFGGDEVVK.A
R.VSQLALYDIR.G
R.LFGVTTLDVVR.A
R.DDLFNTNASIVR.D
14
B37 (-) ATP synthase F1, beta subunit XP_753589 (gi|70997705) 5.30/55.6 4.5/32.5 Aspergillus fumigatus 219 3/3 K.AHGGYSVFTGVGER.T
R.EGNDLYHEMQETGVIQLEGESK.V + OM
K.SLQDIIAILGMDELSEADKLTVER.A + OM
11
C27 (2, 3) hypothetical protein (ketol-acid reducto-isomerase) XP_363882 (gi|39952331) 8.22/44.9 6.3/54.9 Magnaporthe grisea 154 2/4 R.DNGLNVIIGVR.K
K.DDTLALIGYGSQGHGQGLNLR.D
8
C34 (2, 3) peptidyl-prolyl cis-trans isomerase B precursor (cyclophilin) XP_001728304 (gi|1164426123) 8.61/22.5 6.1/40.0 Neurospora crassa 69 3/4 R.IVMGLYGK.T + OM
K.GLLSMANAGK.D + OM
K.HVVFGEVLEGYDVVEK.I
16
D1 (2) ATP synthase F1, subunit beta XP_753589 (gi|70997705) 5.30/55.6 5.3/58.9 Aspergillus fumigatus 8540 22/277 K.LVDLK.D
K.IGLFGGAGVGK.T
K.LVDLKDTIR.S
K.VVDLLAPYAR.G
R.VQQMLQEYK.S + OM
K.IHQVIGAVVDVK.F
R.TIAMDGTEGLTR.G + OM
R.IVNVTGDPIDER.G
R.FTQAGSEVSALLGR.I
K.AHGGYSVFTGVGER.T
R.VALTGLTIAEYFR.D
K.TVFIQELINNIAK.A
K.VALVFGQMNEPPGAR.A + OM
R.GISELGIYPAVDPLDSK.S
R.DEEGQDVLLFIDNIFR.F
R.FLSQPFTVAQVFTGIEGK.L
K.SLQDIIAILGMDELSEADK.L
R.EGNDLYHEMQETGVIQLEGESK.V + OM
K.SLQDIIAILGMDELSEADKLTVER.A + OM
K.AIINGEGDDLPEAAFYMVGDFESAR.A + OM
R.TREGNDLYHEMQETGVIQLEGESK.V + OM
K.GSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSR.G
58
D11 (-) 3-isopropyl-malate dehydrogenase XP_752944 (gi|70996378) 5.32/39.3 5.5/47.0 Aspergillus fumigatus 323 5/13 R.NVIEAGIR.T
R.GVDFNIIR.E
R.ELTGGIYFGDR.K
K.NADAVLLGAIGGPK.W
K.VNGIYEPIHGSAPDIAGK.G
16
E1 (2, 3) RACK1-like protein ABA33785 (gi|75993570) 6.59/35.5 6.3/51.3 Para-coccidioides brasiliensis 271 7/13 K.FTITDK.G
R.LWELATGNTTR.T
K.VDELKPEYVEK.G
K.DGTTMLWDLNESK.H + OM
K.SKVDELKPEYVEK.G
R.FSPNPQNPVIVSAGWDK.L
R.IQTDHIGHTGYINTVTISPDGSLCASGGK.D
28
E11 (2, 3) hypothetical protein (aconitase) XP_001393157 (gi|145241021) 6.18/84.9 5.7/66.2 Aspergillus niger 536 10/21 K.DIILK.V
K.FNPLTDK.L
K.GNYINYKK.M
R.HLGGLAIITR.S
K.FNPLTDKLK.D
K.SLFTVTPGSEQIR.A
K.EVYDFLASACAK.Y
K.KGEANSIVSSYNR.N
K.VGLIGSCTNSSYEDMSR.G + OM
R.GHLDNISNNMLIGAINEANGEANKVK.N + OM
11
E19 (-) glyceraldehyde 3-phosphate dehydrogenase ABV02551 (gi|157057025) 7.01/36.6 7.1/50.0 Penicillium marneffei 818 12/31 K.VGINGFGR.I
K.YDTQHGQFK.G
K.GTIEVEGSDLIVNGK.R
K.FYQERDPANIK.W
K.SSDTIISNASCTTNCLAPLAK.I
R.TAAQNIIPSSTGAAK.A
K.VIPALNGK.L
K.LTGMSMRVPTSNVSVVDLTCR.T
R.TEKPVSYDEIK.A
K.KYAEGELK.G
K.GIMGYTEDDVVSTDMNGNSNSSVFDAK.A + OM
K.AGIALNSNFIK.L
48
E26 (-) 60s ribosomal protein L2 XP_362607 (gi|39946140) 10.89/40.0 6.8/54.0 Magnaporthe grisea 132 3/3 K.DFLLPSNVVSQADLTR.L
R.LINSSEIQSVLR.A
R.LINSSEIQSVLRAPKGTAR.T
9
F46 (2) enolase Q76KF9 (gi|74662366) 5.14/47.3 6.0/58.1 Penicillium chrysogenum 850 11/35 K.LNQILR.I
K.VDEFLNK.L
K.SCNALLLK.V
K.KYDLDFK.N
K.IAMDVASSEFYK.E + OM
K.GVPLYAHISDLAGTK.K
K.WLTYEQLADLYK.S
K.VNQIGTLTESIQAAK.D
R.GNPTVEVDVVTETGLHR.A
K.TSDFQIVGDDLTVTNPLR.I
R.LAFQEFMIVPDTAPTFSEGLR.Q + OM
31
  1. a Spot, spot number corresponds to labeled spots in Figs. 2 and 3 (as indicated in parentheses); Protein name, matched protein description; NCBI Accession (Version), accession number and submission version of matched protein from NCBI database; Theo. pI/M r (kDa), theoretical isoelectric point and molecular mass based on amino acid sequence of the identified protein; Expt. pI/M r (kDa), experimental isoelectric point and molecular mass estimated from the 2DGE gels; Species, the fungal species of the matched protein; Mascot score, score obtained from the Mascot search for each match; NP, the number of matched peptides; PD, the number of peptides detected; MS/MS Peptide Sequence, amino acid sequences of peptides identified by Nano-LC/MS/MS; OM, oxidized methionine residue; SC, percent amino acid sequence coverage for the identified protein.