Skip to main content

Advertisement

Table 1 Identification of proteins expressed at equivalent levels in developing yeast and mould phases of P. marneffei.a

From: Protein profiling of the dimorphic, pathogenic fungus, Penicillium marneffei

Spot (Fig.) Protein Name NCBI Accession (Version) Theo. pI/M r (kDa) Expt. pI/M r (kDa) Species Mascot Score NP/PD MS/MS Peptide Sequence SC (%)
B27 (2, 3) hypothetical protein (malate dehydrogenase) XP_001817504 (gi|169766066) 8.79/35.7 5.8/52.6 Aspergillus oryzae 2597 9/122 R.VSELALYDIR.G K.RLFGVTTLDVVR.A R.LFGVTTLDVVR.A R.MAESLLK.A + OM R.IQFGGDEVVK.A R.DDLFNTNASIVR.D K.DGAGSATLSMAMAGAR.M + 2 OM K.AKDGAGSATLSMAMAGAR.F + 2 OM K.VELGPNGVEKILPVGQVNAYEEK.L 27
B29 (2, 3) Cu,Zn-superoxide dismutase ABD67502 (gi|89329757) 5.74/16.1 5.9/35.0 Penicillium marneffei 5183 9/139 M.VKAVAVLR.G K.GTVTFEQADENSPTTISWNITGHDANAER.G K.THGAPTDDER.H K.THGAPTDDERHVGDLGNFK.T R.HVGDLGNFK.T K.TDAQGNAVGFVEDK.L K.LIGAESVLGR.T R.TIVVHAGTDDLGR.G K.TGNAGPRPACGVIGISA.- 71
B30 (2, 3) hypothetical protein (peroxiredoxin) XP_001226164 (gi|116200704) 5.57/25.1 6.1/45.9 Chaetomium globosum 202 2/25 R.VVKPYLR.F R.TILSYPASTGR.N K.IAYLYDMIDYQDTTNVDEK.G + OM R.KIAYLYDMIDYQDTTNVDEK.G + OM 16
B31 (2, 3) hypothetical protein (nucleotide diphosphate kinase) XP_001393898 (gi|145242650) 8.45/17.2 6.5/33.9 Aspergillus niger 413 5/127 R.GLVGPIISR.F R.TILGATNPLASAPGTIR.G R.GDYAIDVGR.N R.NVCHGSDSVENAQK.E K.HSQFDWIYEK.A 38
B33 (2, 3) hypothetical protein (malate dehydrogenase) XP_001246025 (gi|119190837) 9.19/36.0 6.1/45.9 Coccidioides immitis 328 5/9 R.FAESLLK.A R.IQFGGDEVVK.A R.VSQLALYDIR.G R.LFGVTTLDVVR.A R.DDLFNTNASIVR.D 14
B37 (-) ATP synthase F1, beta subunit XP_753589 (gi|70997705) 5.30/55.6 4.5/32.5 Aspergillus fumigatus 219 3/3 K.AHGGYSVFTGVGER.T R.EGNDLYHEMQETGVIQLEGESK.V + OM K.SLQDIIAILGMDELSEADKLTVER.A + OM 11
C27 (2, 3) hypothetical protein (ketol-acid reducto-isomerase) XP_363882 (gi|39952331) 8.22/44.9 6.3/54.9 Magnaporthe grisea 154 2/4 R.DNGLNVIIGVR.K K.DDTLALIGYGSQGHGQGLNLR.D 8
C34 (2, 3) peptidyl-prolyl cis-trans isomerase B precursor (cyclophilin) XP_001728304 (gi|1164426123) 8.61/22.5 6.1/40.0 Neurospora crassa 69 3/4 R.IVMGLYGK.T + OM K.GLLSMANAGK.D + OM K.HVVFGEVLEGYDVVEK.I 16
D1 (2) ATP synthase F1, subunit beta XP_753589 (gi|70997705) 5.30/55.6 5.3/58.9 Aspergillus fumigatus 8540 22/277 K.LVDLK.D K.IGLFGGAGVGK.T K.LVDLKDTIR.S K.VVDLLAPYAR.G R.VQQMLQEYK.S + OM K.IHQVIGAVVDVK.F R.TIAMDGTEGLTR.G + OM R.IVNVTGDPIDER.G R.FTQAGSEVSALLGR.I K.AHGGYSVFTGVGER.T R.VALTGLTIAEYFR.D K.TVFIQELINNIAK.A K.VALVFGQMNEPPGAR.A + OM R.GISELGIYPAVDPLDSK.S R.DEEGQDVLLFIDNIFR.F R.FLSQPFTVAQVFTGIEGK.L K.SLQDIIAILGMDELSEADK.L R.EGNDLYHEMQETGVIQLEGESK.V + OM K.SLQDIIAILGMDELSEADKLTVER.A + OM K.AIINGEGDDLPEAAFYMVGDFESAR.A + OM R.TREGNDLYHEMQETGVIQLEGESK.V + OM K.GSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSR.G 58
D11 (-) 3-isopropyl-malate dehydrogenase XP_752944 (gi|70996378) 5.32/39.3 5.5/47.0 Aspergillus fumigatus 323 5/13 R.NVIEAGIR.T R.GVDFNIIR.E R.ELTGGIYFGDR.K K.NADAVLLGAIGGPK.W K.VNGIYEPIHGSAPDIAGK.G 16
E1 (2, 3) RACK1-like protein ABA33785 (gi|75993570) 6.59/35.5 6.3/51.3 Para-coccidioides brasiliensis 271 7/13 K.FTITDK.G R.LWELATGNTTR.T K.VDELKPEYVEK.G K.DGTTMLWDLNESK.H + OM K.SKVDELKPEYVEK.G R.FSPNPQNPVIVSAGWDK.L R.IQTDHIGHTGYINTVTISPDGSLCASGGK.D 28
E11 (2, 3) hypothetical protein (aconitase) XP_001393157 (gi|145241021) 6.18/84.9 5.7/66.2 Aspergillus niger 536 10/21 K.DIILK.V K.FNPLTDK.L K.GNYINYKK.M R.HLGGLAIITR.S K.FNPLTDKLK.D K.SLFTVTPGSEQIR.A K.EVYDFLASACAK.Y K.KGEANSIVSSYNR.N K.VGLIGSCTNSSYEDMSR.G + OM R.GHLDNISNNMLIGAINEANGEANKVK.N + OM 11
E19 (-) glyceraldehyde 3-phosphate dehydrogenase ABV02551 (gi|157057025) 7.01/36.6 7.1/50.0 Penicillium marneffei 818 12/31 K.VGINGFGR.I K.YDTQHGQFK.G K.GTIEVEGSDLIVNGK.R K.FYQERDPANIK.W K.SSDTIISNASCTTNCLAPLAK.I R.TAAQNIIPSSTGAAK.A K.VIPALNGK.L K.LTGMSMRVPTSNVSVVDLTCR.T R.TEKPVSYDEIK.A K.KYAEGELK.G K.GIMGYTEDDVVSTDMNGNSNSSVFDAK.A + OM K.AGIALNSNFIK.L 48
E26 (-) 60s ribosomal protein L2 XP_362607 (gi|39946140) 10.89/40.0 6.8/54.0 Magnaporthe grisea 132 3/3 K.DFLLPSNVVSQADLTR.L R.LINSSEIQSVLR.A R.LINSSEIQSVLRAPKGTAR.T 9
F46 (2) enolase Q76KF9 (gi|74662366) 5.14/47.3 6.0/58.1 Penicillium chrysogenum 850 11/35 K.LNQILR.I K.VDEFLNK.L K.SCNALLLK.V K.KYDLDFK.N K.IAMDVASSEFYK.E + OM K.GVPLYAHISDLAGTK.K K.WLTYEQLADLYK.S K.VNQIGTLTESIQAAK.D R.GNPTVEVDVVTETGLHR.A K.TSDFQIVGDDLTVTNPLR.I R.LAFQEFMIVPDTAPTFSEGLR.Q + OM 31
  1. a Spot, spot number corresponds to labeled spots in Figs. 2 and 3 (as indicated in parentheses); Protein name, matched protein description; NCBI Accession (Version), accession number and submission version of matched protein from NCBI database; Theo. pI/M r (kDa), theoretical isoelectric point and molecular mass based on amino acid sequence of the identified protein; Expt. pI/M r (kDa), experimental isoelectric point and molecular mass estimated from the 2DGE gels; Species, the fungal species of the matched protein; Mascot score, score obtained from the Mascot search for each match; NP, the number of matched peptides; PD, the number of peptides detected; MS/MS Peptide Sequence, amino acid sequences of peptides identified by Nano-LC/MS/MS; OM, oxidized methionine residue; SC, percent amino acid sequence coverage for the identified protein.