Skip to main content

Advertisement

Table 3 Identification of preferentially expressed proteins in the developing yeast phase of P. marneffei.a

From: Protein profiling of the dimorphic, pathogenic fungus, Penicillium marneffei

Spot (Fig.) Protein Name NCBI Accession (Version) Theo. pI/M r (kDa) Expt. pI/M r (kDa) Species Mascot Score NP/PD MS/MS Peptide Sequence SC (%)
A1 (2) Ran GTPase spi1 NP_596827 (gi|19113619) 7.00/24.8 5.7/45.9 Schizosaccharomyces pombe 173 3/3 R.HLTGEFEK.K K.LVLVGDGGTGK.T K.NLQYYDISAK.S 13
A2 (2) succinyl-CoA synthetase alpha subunit DQ666366 (gi|110227027) 5.88/27.7 7.0/54.4 Penicillium marneffei 321 5/5 K.TLRDEFVR.R R.MGHAGAIVSGGK.G + OM K.IGIMPGFIHK.R + OM K.ISALEAAGVIVER.S K.AGTTHLDLPVFATVSDAVK.E 23
A3 (2,3) heat shock protein 30 ABF82266 (gi|106647229) 6.17/20.7 6.2/45.0 Penicillium marneffei 752 9/31 R.SGDFAPLFR.L R.LLDDYDLHR.S R.DGQTPASSSISSFAPR.F K.DAYHLDGELPGIAQK.D K.DVEIEFSDPQTLTIK.G R.EYHTLPENENPHAPKPASVEDAPESSDETAVQ K.S R.SVGEFHR.S K.ASLKNGVLTVTVPK.A K.NGVLTVTVPK.A 66
B23 (3) NAD-dependent formate dehydrogenase XP_001270055 (gi|121703582) 7.65/46.2 6.5/57.4 Aspergillus clavatus 181 3/26 K.NEYDLENK.V K.VVGTVAVGR.I K.VLMVLYDGGEHAK.Q + OM 7
B38 (2) antigenic mitochondrial protein HSP60 EAL93225 (gi|71001164) 5.53/62.1 5.6/61.8 Aspergillus fumigatus 1000 13/57 K.FENLGAR.L K.LSGGVAVIK.V R.LLQDVASK.T K.AVTSTLGPK.G R.AIFSETVK.N R.GQLQVAAVK.A R.VVDALNATR.A K.APGFGDNRK.S K.VGGASEVEVGEK.K K.EDTIILNGEGSK.D K.NVAAGCNPMDLR.R + OM K.VEFEKPLILLSEK.K R.GVMADPSTSEYEKEK.L + OM 22
B40 (-) ATP synthase F1, subunit beta XP_753589 (gi|70997705) 5.30/55.6 4.2/47.0 Aspergillus fumigatus 1047 12/17 K.IGLFGGAGVGK.T K.VVDLLAPYAR.G K.IHQVIGAVVDVK.F R.FTQAGSEVSALLGR.I K.AHGGYSVFTGVGER.T K.TVFIQELINNIAK.A K.VALVFGQMNEPPGAR.A + OM R.GISELGIYPAVDPLDSK.S R.FLSQPFTVAQVFTGIEGK.L R.EGNDLYHEMQETGVIQLEGESK.V + OM K.SLQDIIAILGMDELSEADKLTVER.A + OM K.GSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSR.G 39
C25 (3) Phospho-glycerate kinase XP_752401 (gi|70995281) 6.31/44.8 6.4/59.7 Aspergillus fumigatus 391 8/11 K.TVGDIIEK.A R.IVGALPTIK.Y K.IQLIDNLLPK.V K.ASGGQVILLENLR.F R.AHSSMVGVDLPQK.A + OM K.YSLKPVVPELEK.L K.VSDKIQLIDNLLPK.V K.LSHVSTGGGASLELLEGK.E 20
D7 (2) hypothetical protein (activator of HSP90 ATPase) EAS36198 (gi|90306567) 5.11/36.5 6.1/56.1 Coccidioides immitis 164 2/7 K.IVSMDGDVDVSQR.K + OM R.TTAEEMYTTFTDPQR.L 8
D15 (-) cell division control protein Cdc48 XP_756045 (gi|71002728) 5.09/90.5 5.1/67.4 Aspergillus fumigatus 221 3/3 R.EVDIGIPDPTGR.L R.VVSQLLTLMDGMK.A + 2 OM R.VVNQLLTEMDGMTSK.K + 2 OM 4
D16 (-) heat shock protein 70 AAX63812 (gi|62125797) 5.03/69.6 5.1/64.0 Penicillium marneffei 1544 21/36 R.TKDNNLLGK.F R.LSKEEIER.M K.EKLEAEIEK.T R.LVNHFASEFK.R K.FELTGIPPAPR.G K.FSDPEVQADAK.H K.DAGLIAGLNVLR.I R.IEIIANDQGNR.T K.YKAEDEAEATR.I R.KFSDPEVQADAK.H K.SSVHEIVLVGGSTR.I K.LVTDFFNKEPNK.S R.TTPSFVAFTDSER.L R.EADEVEERPEELD.- R.DDRIEIIANDQGNR.T K.QFTPEEISSMVLIK.M + OM K.ATAGDTHLGGEDFDSR.L K.NQVAMNPHNTVFDAK.R + OM R.IINEPTAAAIAYGLDKK.V K.SINPDEAVAYGAAVQAAILSGDTSSK.S R.GVPQIEVTFDMDANGIMNVSAVEK.G + 2 OM 40
D18 (-) hypothetical protein (UDP-N-acetylglucosamine pyrophos-phorylase) XP_682363 (gi|67904214) 6.03/56.0 5.9/61.2 Aspergillus nidulans 160 3/3 K.SLFQLQAER.I R.REDEFSPLK.N R.NATESVGLILQK.N 5
E7 (-) adenylate kinase XP_750499 (gi|70991300) 7.71/28.9 6.3/44.8 Aspergillus fumigatus 206 3/6 K.SIAEQMR.I + OM K.NGFILDGFPR.T K.IMDQGGLVSDEIMVNMIK.N + 3 OM 13
  1. a Spot, spot number corresponds to labeled spots in Figs. 2 and 3 (as indicated in parentheses); Protein name, matched protein description; NCBI Accession (Version), accession number and submission version of matched protein from NCBI database; Theo. pI/M r (kDa), theoretical isoelectric point and molecular mass based on amino acid sequence of the identified protein; Expt. pI/M r (kDa), experimental isoelectric point and molecular mass estimated from the 2DGE gels; Species, the fungal species of the matched protein; Mascot score, score obtained from the Mascot search for each match; NP, the number of matched peptides; PD, the number of peptides detected; MS/MS Peptide Sequence, amino acid sequences of peptides identified by Nano-LC/MS/MS; OM, oxidized methionine residue; SC, percent amino acid sequence coverage for the identified protein.