Skip to main content

Table 3 Identification of preferentially expressed proteins in the developing yeast phase of P. marneffei.a

From: Protein profiling of the dimorphic, pathogenic fungus, Penicillium marneffei

Spot (Fig.) Protein Name NCBI Accession (Version) Theo. pI/M r (kDa) Expt. pI/M r (kDa) Species Mascot Score NP/PD MS/MS Peptide Sequence SC (%)
A1 (2) Ran GTPase spi1 NP_596827 (gi|19113619) 7.00/24.8 5.7/45.9 Schizosaccharomyces pombe 173 3/3 R.HLTGEFEK.K
K.LVLVGDGGTGK.T
K.NLQYYDISAK.S
13
A2 (2) succinyl-CoA synthetase alpha subunit DQ666366 (gi|110227027) 5.88/27.7 7.0/54.4 Penicillium marneffei 321 5/5 K.TLRDEFVR.R
R.MGHAGAIVSGGK.G + OM
K.IGIMPGFIHK.R + OM
K.ISALEAAGVIVER.S
K.AGTTHLDLPVFATVSDAVK.E
23
A3 (2,3) heat shock protein 30 ABF82266 (gi|106647229) 6.17/20.7 6.2/45.0 Penicillium marneffei 752 9/31 R.SGDFAPLFR.L
R.LLDDYDLHR.S
R.DGQTPASSSISSFAPR.F
K.DAYHLDGELPGIAQK.D
K.DVEIEFSDPQTLTIK.G
R.EYHTLPENENPHAPKPASVEDAPESSDETAVQ K.S
R.SVGEFHR.S
K.ASLKNGVLTVTVPK.A
K.NGVLTVTVPK.A
66
B23 (3) NAD-dependent formate dehydrogenase XP_001270055 (gi|121703582) 7.65/46.2 6.5/57.4 Aspergillus clavatus 181 3/26 K.NEYDLENK.V
K.VVGTVAVGR.I
K.VLMVLYDGGEHAK.Q + OM
7
B38 (2) antigenic mitochondrial protein HSP60 EAL93225 (gi|71001164) 5.53/62.1 5.6/61.8 Aspergillus fumigatus 1000 13/57 K.FENLGAR.L
K.LSGGVAVIK.V
R.LLQDVASK.T
K.AVTSTLGPK.G
R.AIFSETVK.N
R.GQLQVAAVK.A
R.VVDALNATR.A
K.APGFGDNRK.S
K.VGGASEVEVGEK.K
K.EDTIILNGEGSK.D
K.NVAAGCNPMDLR.R + OM
K.VEFEKPLILLSEK.K
R.GVMADPSTSEYEKEK.L + OM
22
B40 (-) ATP synthase F1, subunit beta XP_753589 (gi|70997705) 5.30/55.6 4.2/47.0 Aspergillus fumigatus 1047 12/17 K.IGLFGGAGVGK.T
K.VVDLLAPYAR.G
K.IHQVIGAVVDVK.F
R.FTQAGSEVSALLGR.I
K.AHGGYSVFTGVGER.T
K.TVFIQELINNIAK.A
K.VALVFGQMNEPPGAR.A + OM
R.GISELGIYPAVDPLDSK.S
R.FLSQPFTVAQVFTGIEGK.L
R.EGNDLYHEMQETGVIQLEGESK.V + OM
K.SLQDIIAILGMDELSEADKLTVER.A + OM
K.GSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSR.G
39
C25 (3) Phospho-glycerate kinase XP_752401 (gi|70995281) 6.31/44.8 6.4/59.7 Aspergillus fumigatus 391 8/11 K.TVGDIIEK.A
R.IVGALPTIK.Y
K.IQLIDNLLPK.V
K.ASGGQVILLENLR.F
R.AHSSMVGVDLPQK.A + OM
K.YSLKPVVPELEK.L
K.VSDKIQLIDNLLPK.V
K.LSHVSTGGGASLELLEGK.E
20
D7 (2) hypothetical protein (activator of HSP90 ATPase) EAS36198 (gi|90306567) 5.11/36.5 6.1/56.1 Coccidioides immitis 164 2/7 K.IVSMDGDVDVSQR.K + OM
R.TTAEEMYTTFTDPQR.L
8
D15 (-) cell division control protein Cdc48 XP_756045 (gi|71002728) 5.09/90.5 5.1/67.4 Aspergillus fumigatus 221 3/3 R.EVDIGIPDPTGR.L
R.VVSQLLTLMDGMK.A + 2 OM
R.VVNQLLTEMDGMTSK.K + 2 OM
4
D16 (-) heat shock protein 70 AAX63812 (gi|62125797) 5.03/69.6 5.1/64.0 Penicillium marneffei 1544 21/36 R.TKDNNLLGK.F
R.LSKEEIER.M
K.EKLEAEIEK.T
R.LVNHFASEFK.R
K.FELTGIPPAPR.G
K.FSDPEVQADAK.H
K.DAGLIAGLNVLR.I
R.IEIIANDQGNR.T
K.YKAEDEAEATR.I
R.KFSDPEVQADAK.H
K.SSVHEIVLVGGSTR.I
K.LVTDFFNKEPNK.S
R.TTPSFVAFTDSER.L
R.EADEVEERPEELD.-
R.DDRIEIIANDQGNR.T
K.QFTPEEISSMVLIK.M + OM
K.ATAGDTHLGGEDFDSR.L
K.NQVAMNPHNTVFDAK.R + OM
R.IINEPTAAAIAYGLDKK.V
K.SINPDEAVAYGAAVQAAILSGDTSSK.S
R.GVPQIEVTFDMDANGIMNVSAVEK.G + 2 OM
40
D18 (-) hypothetical protein (UDP-N-acetylglucosamine pyrophos-phorylase) XP_682363 (gi|67904214) 6.03/56.0 5.9/61.2 Aspergillus nidulans 160 3/3 K.SLFQLQAER.I
R.REDEFSPLK.N
R.NATESVGLILQK.N
5
E7 (-) adenylate kinase XP_750499 (gi|70991300) 7.71/28.9 6.3/44.8 Aspergillus fumigatus 206 3/6 K.SIAEQMR.I + OM
K.NGFILDGFPR.T
K.IMDQGGLVSDEIMVNMIK.N + 3 OM
13
  1. a Spot, spot number corresponds to labeled spots in Figs. 2 and 3 (as indicated in parentheses); Protein name, matched protein description; NCBI Accession (Version), accession number and submission version of matched protein from NCBI database; Theo. pI/M r (kDa), theoretical isoelectric point and molecular mass based on amino acid sequence of the identified protein; Expt. pI/M r (kDa), experimental isoelectric point and molecular mass estimated from the 2DGE gels; Species, the fungal species of the matched protein; Mascot score, score obtained from the Mascot search for each match; NP, the number of matched peptides; PD, the number of peptides detected; MS/MS Peptide Sequence, amino acid sequences of peptides identified by Nano-LC/MS/MS; OM, oxidized methionine residue; SC, percent amino acid sequence coverage for the identified protein.