Skip to main content

Table 8 MS/MS identification results

From: Prediction of outcome of non-small cell lung cancer patients treated with chemotherapy and bortezomib by time-course MALDI-TOF-MS serum peptide profiling

Peptide ID m/z Peptide residue location Peptide amino acid sequence Signature(s)
BK 904.4676 381-388 RPPGFSPF Time course (44)
P-FPA 1616,6366 20-35 ADS*GEGDFLAEGGGVR Time course (44); PFS (13);
Response (10);
NSCLC vs. Healthy (47)
FPA 1536,6906 20-35 ADSGEGDFLAEGGGVR Time course (44)
FPA 1350,6275 22-35 SGEGDFLAEGGGVR Time course (44)
FPA 1263,5958 23-35 GEGDFLAEGGGVR Time course (44)
Glu-FPB 1552.669 31-44 EGVNDNEEGFFSA Time course (44)
FPB 1129.4849 34-43 NDNEEGFFSAR Time course (44)
C3f 1865,0022 1304-1319 SSKITHRIHWESASLL Time course (44)
C3f 1777,966 1305-1319 SKITHRIHWESASLL Time course (44)
C3f 1690,9254 1306-1319 KITHRIHWESASLL Time course (44)
C3 beta 2324,1475 23-42 SPMYSIITPNILRLESEETM NSCLC vs. Healthy (47)
C3 beta 2193,1036 23-41 SPMYSIITPNILRLESEET NSCLC vs. Healthy (47)
Hbα 3473,7545 2-34 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF NSCLC vs. Healthy (47)
Hbα 3326,6863 2-33 VLSPADKTNVKAAWGKVGAHAGEYGAEALERM NSCLC vs. Healthy (47)
seAlb 2567,3659 27-48 HKSEVAHRFKDLGEENFKALVL Time course (44)
ITIH4 3156,6207 617-644 NVHSGSTFFKYYLQGAKIPKPEASFSPR Time course (44);
NSCLC vs. Healthy (47)
CFXIII A 2602,3048 43-67 AVPPNNSNAAEDDLPTVELQGVVPR Time course (44)
  1. Peptides were identified from the 44-peptide ion time course signature ("time course (44)"), the 13-peptide ion "long PFS" vs. "short PFS" signature ("PFS (13)"), the 10-peptide ion "PR" vs. "no PR" signature ("Response (10)") and the 47-peptide ion NSCLC vs. Healthy comparison ("NSCLC vs. Healthy (47)"). Abbreviations: FPA: fibrinopeptide A; P-FPA: phospho-fibrinopeptide A (phosphorylation site indicated by *); FBP: fibrinopeptide B; Glu-FBP: Glu-1-Fibrinopeptide B; C3f: complement C3f; C3b: complement C3beta; Hb alpha: hemoglobin alpha; seAlb: serum albumen; ITIH4: inter-alpha-trypsin inhibitor heavy chain H4; CFXIIIA: coagulation factor XIIIA.