Skip to main content

Table 2 Identification results of peptides in QC model

From: Serum peptidome based biomarkers searching for monitoring minimal residual disease in adult acute lymphocytic leukemia

Molecular weight Amino acid sequence International Protein Index Peptide name
2661.27 Da DEAGSEADHEGTHSTKRGHAKSRPV IPI00021885 fibrinogen alpha chain
2991.46 Da MLLADQGQSWKEEVVTVETWQEGSLK IPI00219757.13 glutathione S- transferase P1
3443.92 Da HRHPDEAAFFDTASTGKTFPGFFSPMLGEFV IPI00021885.1 isoform 1 of fibrinogen alpha chain precursor
7764.29 Da EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES IPI 00022446 platelet factor 4