Skip to main content

Table 4 Prediction of B cell epitopes in B9N9W6

From: Analysis of allergen components and identification of bioactivity of HSP70 in pollen of Populus deltoides

Epitope peptide Position
GRRFSDPSVQSDMKHWPF 78-95
KASGVKNKITITNDKGRLGKDDIERMVQEAERYKAEDEKVKKKVEAKNA 499-547
NTVRDDKVGGKLDPADKQKIEKEIEETIDWLDRNQLAEVDEFEDK 557-601
QGAGGDVPMGGGAQMPGGAYSKASSGGSGAGPKI 618-651
  1. Note: Bepipred Linear Epitope Prediction 2.0 was selected to predict the B cell Epitope, which analyzed the sequence characteristics of antigen and used the size of amino acid residues to predict the B cell epitopes