Skip to main content

Table 1 Results of peptide mass fingerprinting (PMF) for identification of water buffalo (Bubalus bubalis) and goat meat (Capra hircus) myoglobins

From: Proteomic based approach for characterizing 4-hydroxy-2-nonenal induced oxidation of buffalo (Bubalus bubalis) and goat (Capra hircus) meat myoglobins

Species Accession No. Score No. matched peptides Nominal mass Observed mass % Sequence coverage highlighting the matched peptides
Buffalo (Bubalusbubalis) giI116248552 289 4 17155.0 17043.6 Sequence coverage = 39.61%
MGLSDGEWQLVLNAWGKVETDVAGHGQEVL IRLFTGHPET LEKFDKFKHL KTEAEMKASE DLKKHGNTVLTALGGILKKK GHHEAEVKHL AESHANKHKI PVKYLEFISDAIIHVLHDKH PSDFGADAQA AMSKALELFR NEMAAQYKVL GFHG
Goat (Capra hircus) giI118595750 79 6 17043.0 16899.9 Sequence coverage = 41.55%
MGLSDGEWTLVLNAWGKVEADVAGHGQEVLIRLFTGHPET LEKFDKFKHL KTGAEMKASE DLKKHGNTVLTALGGILKKK GHHEAEVKHL AESHANKHKI PVKYLEFISD AIIHVLHAKH PSDFGADAQG AMSKALELFRNDMAAQYKVL GFQG